YÜKSEK PERFORMANSLI WEB HOSTİNG KESİNTİSİZ, HIZLI, GÜVENLİ VE YÜKSEK PERFORMANSLI WEB HOSTİNG PAKETLERİ

BAşLANGıç

₺80 /Yıl Yıllık Fiyatı ₺100 Satın Al
  • 1 GB Web Alanı
  • 100 GB Aylık Trafik
  • 1 Web site Barındırma
  • 1 MySQL Veritabanı
  • 3 Alt Alan Adı
  • 3 Eposta Adeti
  • Türkçe Kontrol Paneli
  • Tek tuşla script kurulumu
  • DDos Koruma
  • Seo Araçları
  • Antivürüs Tarayıcı
  • 24/7/365 Teknik Destek
  • Günlük Yedekleme (Son 15 gün)
  • 99.9% Uptime Garantisi

GELIşMIş

₺180 /Yıl Yıllık Fiyatı ₺200 Satın Al
  • 5 GB Web Alanı
  • 500 GB Aylık Trafik
  • 5 Web site Barındırma
  • 10 MySQL Veritabanı
  • 10 Alt Alan Adı
  • 10 Eposta Adeti
  • Türkçe Kontrol Paneli
  • Tek tuşla script kurulumu
  • DDos Koruma
  • Seo Araçları
  • Antivürüs Tarayıcı
  • 24/7/365 Teknik Destek
  • Günlük Yedekleme (Son 15 gün)
  • 99.9% Uptime Garantisi

KURUMSAL

₺250 /Yıl Yıllık Fiyatı ₺270 Satın Al
  • 5 GB Web Alanı
  • Sınırsız Aylık Trafik
  • 5 Web site Barındırma
  • Sınırsız MySQL Veritabanı
  • Sınırsız Alt Alan Adı
  • Sınırsız Eposta Adeti
  • Türkçe Kontrol Paneli
  • Tek tuşla script kurulumu
  • DDos Koruma
  • Seo Araçları
  • Antivürüs Tarayıcı
  • 24/7/365 Teknik Destek
  • Günlük Yedekleme (Son 15 gün)
  • 99.9% Uptime Garantisi

PROFESYONEL

₺320 /Yıl Yıllık Fiyatı ₺350 Satın Al
  • 10 GB Web Alanı
  • Sınırsız Aylık Trafik
  • 10 Web site Barındırma
  • Sınırsız MySQL Veritabanı
  • Sınırsız Alt Alan Adı
  • Sınırsız Eposta Adeti
  • Türkçe Kontrol Paneli
  • Tek tuşla script kurulumu
  • DDos Koruma
  • Seo Araçları
  • Antivürüs Tarayıcı
  • 24/7/365 Teknik Destek
  • Günlük Yedekleme (Son 15 gün)
  • 99.9% Uptime Garantisi

XSUNUCU WEB HOSTİNG

En Hızlı Web Hosting

En hızlı web hosting lite speed server.

Türkçe Eposta Hizmeti

İhtiyacınız olan E-posta hesapları Türkçe panelde.

Tam Optimizasyon

Hızlı ve performansı optimize edilmiş lite speed server sunucular.

7/24/365 Teknik Destek

Mesai saatleri içerisinde Telefon, diğer saatlerde ise ticket desteği.

Saldırılara Karşı Güvenlik Duvarı

Web sitelerinize karşı saldırılara önlem için gelişmiş güvenlik duvarı

CloudFlare Entegrasyonu

Üstün güvenlik ve hız cloudflare ile bir tık öndesiniz.

Günlük Yedekleme İmkanı

Stabil ve sorunsuz çalışan MySQL veritabanı.

Tam Optimizasyon

Hızı ve perfomansı optimize edilmiş web hosting sunucular.

30 Gün para iade garantisi

Memnun kalmadığınız hizmetlerimizden 30 gün içinde para iadesi sunuyoruz.

WEB SİTENİZİ BUGÜN YAYINA ALALIM?

Web siteniz anında hazır Script Kurulumu
  • Kullanımı kolay - Tek tuşla script kurun
  • Hazır Scriptler - Yüzlerce hazır script
  • ÜCRETSİZ alan adi, Web hosting, My SQL veritabani, FTP hesabı ve e-posta adresleri
    80'TL den Başlayan Fiyatlarla.
  • Hosting Paketleri
Güçlü Altyapı, Yüksek Performans.
Trafiğinizi Sorun yapmayın
  • Seo araçları ile daha fazla müşteriye ulaşın..
  • Esnek ödeme yöntemi ile sorun yaşamayın
  • Sınırsız trafik ve Web alanı ile tasarruf edin
    80TL'den Başlayan Fiyatlarla.
  • Satın Al
site-img17

TEK TIKLAMA İLE 100'DEN FAZLA SCRİPTİ ÜCRETSİZ YÜKLEYİN

Hızlı ve Güvenli Paylaşımlı Web Hosting

Tüm Web Hostinglerde


Devamı
Sorunsuz Kurulum Wordpress Hosting

Tek Tıkla Wordpress Kurun


Devamı
Güçlü Kaynaklar VPS Hosting

Gelişmiş Bulut Sunucu



Devamı

Sorunuz Mu var?

Web Hosting nedir ve ne için gereklidir.

Web hosting paketleri, internette kişisel veya kurumsal olarak bir web sitesi oluşturmak için gereklidir. Bir hosting paketi satın aldığınızda bilgi işlem merkezlerimizdeki sunucularımız üzerinde, bilgisayarlarınızın sabit sürücüsü gibi bir depolama alanına sahip olursunuz. Hosting sağlayıcısı olarak sizlerin projelerinize ihtiyac olan her şeyi sunmaktayız. Web Hosting olmadan websitenizi hiç kimseye ulaştıramazsınız. Sitelerinizdeki makaleleri, resimleri, videoları barındırmanıza olanak verir ve müşterilerinize bu içerikleri web hosting sayesinde ulaştırabilirsiniz.Web hosting paketlerimiz maksimum hız ve en yüksek seviye güvenlik sunmanın yanı sıra kişisel ihtiyaçlarınıza göre ayarlanmıştır.

Web Hosting'de Trafik Sınırsızmıdır?

Evet, Bazı web hosting paketlerimizde gerçekten trafik limiti yoktur.Trafik limiti olmayan paketlerimizi seçerek müşterilerinize ulaşmanızda sıkıntı yaşamazsınız.

Bana en uygun hosting paketi hangisidir?

Web hosting paketine karar vermeden önce web sitenizin ne gibi işlevlerin olmasını istediğinizi kullanacağınız alanın ne kadar olmasını gerektiğine iyi düşünmelisiniz. Yeni başlayanlar için hosting paketlerinin yüksek olmasına gerek yoktur. Hosting paketlerimizden “Başlangıç” paketini seçebilirler. web sayfanıza ne kadar çok erişim sağlanıyorsa, o kadar büyük bir paket seçmelisiniz.Websitenizin nasıl bir donanıma sahip olması gerektiğinden henüz emin değilseniz, en hesaplı tarifeyi seçin. Gerektiği takdirde, ileride daha büyük bir pakete geçiş yapabilirsiniz.

Bir hosting paketinde birden fazla alan adı ekleyebilirmiyim?

Evet,Paketinize bağlı olarak birden fazla alan adlarını yönlendirme olanağı vardır. Web hosting paketlerimizde birden fazla farklı alan adları veya alt alanadlarını kullanabilirsiniz.

TEKLİFLERİMİZE BİR GÖZ ATIN

reseller-hosting

Sınırsız Web Hosting ile sınırları zorlayın…

Web hosting websitenize maksimum kullanılabilirlik ve en yüksek performansı sunar.SSD sabit diskleri sayesinde sitenizin yüklenme süreleri düşüktür. 24/7 teknik destek, 99.9% Uptime Garantisi.
50TL’den başlayan fiyatlarla

 

Devamı

reseller-hosting

En iyi performans ve sorunsuz hosting reseller deneyimi…

İster Kişisel için ister kendi siteleriniz için toptan bir barındırma çözümü arıyorsanız. Reseller Hosting paketimiz tam size göre! Türkiye’nin ve Avrupa’nın en geniş disk alanı seçeneği, en uygun fiyatla yalnızca kısa bir süre için XSunucu’da! Tüm siteler için e-posta ve MySQL veritabanı ekleme imkanı! Kendinize ve müşterilerinize ihtiyacınız kadar alt özellik tanımlamaları yapabilirsiniz. Barındırdığınız hosting hesaplarınız için CPU hız limiti %100! Çekirdek hızının tamamını siteleriniz için kullanabilirsiniz. ..

 

Devamı

site-img7

Alan adlarınızı sınırsız kaynaklarla yönetim..

Dünya standartlarına uygun fiyatlandırma ve kampanyalarla domain alırken hiç düşünmeden karar verebileceksiniz…

 

Devamı

Ddos korumalı hosting

Saldırılara karşı koruma sistemi ile gözünüz arkada kalmayacak..

Web siteleriniz 10 gbit standart koruma içeren makineler için 10-100 gbit aralığında dilediğiniz koruma sistemini satın alabilirsiniz. Web sitenizin büyüklüğü ve alınan ddos saldırı boyutuna göre koruma satın alabilirsiniz..

 

Devamı

13

İhtiyacınıza göre Almanya yada Amerika lokasyonlar..

Dedicated sunucular %100 olarak size ait olan sunucularda internet erişimi ve donanım birlikte olarak sunduğumuz çözümlerimiz Kiralık Sunucu veya Dedicated Server olarak tanımlanmıştır. Dedicated Sunucu hizmetlerimizde parça garantisi şirketimiz ve datacenterlar tarafından sağlanmaktadır, arıza anında bize sorunu ilettiğinizde en kısa süre içerisinde arızalı parçalar değiştirilmektedir.Kaliteli XSunucu iş ortağı datacenter Network merkezleri üzerinden %99,99 erişim kalitesi ile internete erişebilmektesiniz..

 

Devamı

MUTLU MÜŞTERİLER!

cpanelpleskrapidsslpaypalapachemysqlvmwarenginxcentoslitespeed1ubuntuopteron

More than 200,000 websites hosted

get your website online today

Projects

725865

Clients

27000

Awards

90

Domains

45000

Days

360

XS KAMPANYA - HOSTİNG + ÜCRETSİZ ALAN ADI

Paket - 1 / 90TL/YIL

  • Ücretsiz Alanadı (1 YIL)
  • 500 MB disk
  • 75 GB aylık trafik
  • 1 site barındırma
  • 5 adet Mysql/PgSQL veritabanı
  • 5 adet subdomain
  • 5 adet email adresi
  • Türkçe cPanel kontrol paneli
  • Tek tuşla script kurulumu
  • Antivirüs tarayıcı
  • DDOS koruma
  • SEO Araçları
  • Paylaşımlı IP
  • 7/24 destek sistemi
  • 99% Uptime garantisi
  • SATINAL
Paket - 2 / 120TL/YIL

  • Ücretsiz Alanadı (1 YIL)
  • 1000 MB disk
  • 150 GB aylık trafik
  • 2 site barındırma
  • 5 adet Mysql/PgSQL veritabanı
  • 5 adet subdomain
  • 5 adet email adresi
  • Türkçe cPanel kontrol paneli
  • Tek tuşla script kurulumu
  • Antivirüs tarayıcı
  • DDOS koruma
  • SEO Araçları
  • Paylaşımlı IP
  • 7/24 destek sistemi
  • 99% Uptime garantisi
  • SATINAL

Bu kampanya xs.net.tr üzerinde belirtilen 2 adet paket için geçerlidir. Kampanya bitiş tarihi 31.08.2016. XSunucu İnternet Teknolojileri kampanyayı uzatma veya süresinden önce bitirme hakkını saklı tutar. Kampanya dahilinde sunulan ücretsiz alan adı .com uzantısı (TLD) için geçerlidir ve ücretiz kullanım süresi 1 yıldır. Süre bitiminde alan adınızı o gün belirlenen standart .com domain fiyatı üzerinden yenileyebilirsiniz.