Yüksek Performanslı Almanya Dedicated Sunucular

Almanya lokasyonda ise trafik sınırı yoktur, istediğiniz gibi kullanabilirsiniz. Ayrıca Almanya lokasyon dedicated sunucular için sabit bir IP bloğu tanımlanmamıştır. Bazı paketler için 16 IP alınırken bazı paketlerde bu sayı 80’e ulaşmaktadır. IP ücretleri ve detaylarını öğrenmek için destek ekibine başvurunuz…

Intel Core i5-3450

Intel Core i7-3930K

Intel XEON E5-1650v2

Intel XEON E5-1650v2

Sunucu: Intel Core i5-3450

Sunucu: Intel Core i7-3930K

Sunucu: Intel XEON E5-1650v2

Sunucu: Intel XEON E5-1650v2

İşlemci (Cpu):  4 x 3.50 GHz

İşlemci (Cpu):  6 x 3.8 GHz

İşlemci (Cpu):  6 x 3,5 GHz

İşlemci (Cpu):  6 x 3,5 GHz

RAM:  16 GB DDR3 ECC/REG

RAM:  64 GB DDR3 RAM

RAM:  128 GB DDR3/ECC RAM

RAM:  64 GB DDR3 RAM

Disk (HDD):  2 x 750 GB SSD

Disk (HDD):  2 x 3.000 GB SATA

HDD:1.000GB ssd 3.000GB sata

Disk (HDD):  2 x 1.000 GB SSD

Port:  1 gbit/s

Port:  1 gbit/s

Port:  1 gbit/s

Port:  1 gbit/s

Aylık Trafik:  Sınırsız

Aylık Trafik:  Sınırsız

Aylık Trafik:  Sınırsız

Aylık Trafik:  Sınırsız

₺400/Ay Aylık Fiyatı ₺500
Satın Al

₺500/Ay Aylık Fiyatı ₺600
Satın Al

₺850/Ay Aylık Fiyatı ₺1000
Satın Al

₺700/Ay Aylık Fiyatı ₺800
Satın Al

Tüm Web Hosting Paketlerinde Ortak Özellik

HER ÇEŞİT ALAN
ADINI DESTEKLER
YÜKSEK KAPASİTE MYSQL VERİTABANI
TEK TUŞLA SCRİPT
KURULUMU
99.9% UPTİME
GARANTİSİ
TÜRKÇE KONTROL
PANELİ
ESNEK ÖDEME SEÇENEKLERİ
SSL
SERTİFİKASI DESTEĞİ
ÜCRETSİZ
SİTE TAŞIMA
30 GÜN PARA İADE GARANTİSİ
24/7/365
TEKNİK DESTEK

MÜŞTERİLERİMİZ NE DİYOR

HER SORUNUZUN MUTLAKA BİR CEVAP VAR!

Web Hosting servisi almak istiyorum ancak işlemlerin nasıl yapılacağını bilmiyorum?

Bir web sitenizin olabilmesi için öncelikle firmaniz.com şeklinde bir domain / alan adı belirlemeniz gerekmektedir. Belirlediğiniz bu ismi (Alan adı) kullanabilmeniz için alan adını kendi adınıza tescil ettirmeniz gerekmektedir. Alan adı tescil servisi bu hizmeti kapsamaktadır.

Alan adları satın alınamazlar, asgari bir yıl olmak üzere belirli bir kullanım süresi için tescil edilebilirler. Alan adınızı tescil süresi bitiminde yenilemediğiniz taktirde alan adınızı bir başkası tescil edebilir.

Web sitenizi daha sonra oluşturmak istiyorsanız tescil ettirdiğiniz domain için daha sonra da hosting hizmeti satın alabilirsiniz.

WordPress, Joomla,Vbulletin, SMF kurulumuna yardımcı oluyor musunuz?

XSunucu Farkı İle WordPress,Smf,Vbulletin Joomla, Drupal ve benzeri onlarca hazır script son sürümleri ile kontrol paneliniz’de. Kendinizde Rahatlıkla tek tıklama ile kurabilir takıldığınız noktalarda destek ekibimizden destek alabilirsiniz.

Web siteme, kaç kişi girmiş çıkmış, ne zaman girilmiş gibi detaylı raporları nasıl alabilirim?

XSunucu, müşterilerine tamamıyla ücretsiz olarak sunduğu bir hizmet de “İSTATİSTİKLER” sayfasıdır. Cpanelde bulunan “Awstats” ile yıllık, aylık, haftalık, saatlik hitlere bakabilirsiniz. Ayrıcı hangi arama motorlarından girilmiş, hangi IP’lerden girilmiş, hangi kelimelerden girilmiş olduğunu görebilirsiniz.

Tescil hizmetini XSunucu’dan hosting ürününü başka bir firmadan alabilir miyim?

Evet. Domain tescil hizmetini XSunucu’dan hosting servisini ise başka bir firmadan satın alabilirsiniz.

Web Hosting müşteri kontrol paneli sağlıyor musunuz?

Evet, web hosting kontrol paneli ile kendi başınıza hesaplarınızı kontrol edebilirsiniz, ftp şifre talebi, veritabanı talebi, hosting ve domain kontrol ve destek bildirimi oluşturabilsiniz. Müşteri Panelinde bu bilgileriniz yer almaktadır.

Web Hosting sunucularında yedekleme sistemi var mı?

XSunucu web hosting sunucularında barınan veritabanları , web siteleri, eposta kutuları ve diğer veriler günlük olarak CDP (Continious Data Protection) teknolojisi ile geriye dönük olarak yedeklenmektedir.

Xsunucu’dan Satın aldığım web hosting ürününü daha sonra değiştirebilir miyim ?

Evet, Satın almış olduğunuz bir web hosting ürününden diğer bir web hosting ürününe geçiş yapabilirsiniz. Bu işlem paketinizi genişletme veya daraltma yönünde olabilir.Paket değişikliği işlemini Xsunucu yönetim paneli aracılığı ile otomatik olarak gerçekleştirebilirsiniz.Paket değişikliğini yapamıyorsanız Teknik Destek ekibinden yardım alabilirsiniz.

Tek Tıkla Kurulum Hizmetiniz Nedir?

Tek tık uygulaması Vbulletin, Joomla , WordPress , SMF , Magento , Php Nuke , Drupal ve benzeri yazılımları web sayfanıza Cpanel kontrol panelinden kolaylıkla kurabileceğiniz bir hizmetimizdir.

İş ortaklarımız

cpanelpleskrapidsslpaypalapachemysqlvmwarenginxcentoslitespeed1ubuntuopteron