Yüksek Performanslı Amerika Dedicated Sunucular

Amerika lokasyon makinelerin tümünde Ip bloğu /29 dur. 5 adet kullanılabilir IP verilir. Ekstra Ip tahsis edilmemektedir. Depo sunucusu dışında tüm makinelerin hattı 1 GBit/s 20.000 GB limitlenmiştir, dilerseniz 1 GBit/s hat hızı yerine 100mbit/s sınırsız hat kullanabilirsiniz.

I7-2600

Xeon E3-1220v1

Quad Dual-Core Opteron

AMD Octacore

Sunucu:  I7 – 2600 Preconfigured

Sunucu:  Xeon E3-1220v1

Sunucu:  Quad Dual-Core Opt 8220

Sunucu:  AMD Octacore Preconfig

İşlemci (Cpu):  4 / 8 threads 2.7 GHZ

İşlemci (Cpu):  4 / 4 threads 3.1 GHZ

İşlemci (Cpu):  8 / 8 threads 2.8 GHZ

İşlemci (Cpu):  8 / 8 threads 3.1 GHZ

RAM:  16GB DDR3 RAM

RAM:  32GB DDR3 RAM

RAM:  32GB DDR3 RAM

RAM:  32GB DDR3 RAM

Disk (HDD):  1TB SATA HDD

Disk (HDD):  240GB SSD HDD

HDD: 500 SAS HDD

Disk (HDD):  4TB SATA HDD

Port:  1 gbit/s

Port:  1 gbit/s

Port:  1 gbit/s

Port:  1 gbit/s

Aylık Trafik:  20TB Aylık Transfer

Aylık Trafik:  20TB Aylık Transfer

Aylık Trafik:  20TB Aylık Transfer

Aylık Trafik:  20TB Aylık Transfer

İp:  5 Dedicated IP

İp:  5 Dedicated IP

İp:  5 Dedicated IP

İp:  5 Dedicated IP

₺240/Ay Aylık Fiyatı ₺300
Satın Al

₺290/Ay Aylık Fiyatı ₺350
Satın Al

₺300/Ay Aylık Fiyatı ₺360
Satın Al

₺310/Ay Aylık Fiyatı ₺370
Satın Al

Dedicated Sunucu Nedir ?

%100 olarak size ait olan sunucularda internet erişimi ve donanım birlikte olarak sunduğumuz çözümlerimiz Kiralık Sunucu veya Dedicated Server olarak tanımlanmıştır. Dedicated Sunucu hizmetlerimizde parça garantisi şirketimiz ve datacenterlar tarafından sağlanmaktadır, arıza anında bize sorunu ilettiğinizde 15 dakika içerisinde arızalı parçalar değiştirilmektedir. Kaliteli XSunucu iş ortağı datacenter Network merkezleri üzerinden %99,999 erişim kalitesi ile internete erişebilmektesiniz..

Tüm Web Hosting Paketlerinde Ortak Özellik

HER ÇEŞİT ALAN
ADINI DESTEKLER
YÜKSEK KAPASİTE MYSQL VERİTABANI
TEK TUŞLA SCRİPT
KURULUMU
99.9% UPTİME
GARANTİSİ
TÜRKÇE KONTROL
PANELİ
ESNEK ÖDEME SEÇENEKLERİ
SSL
SERTİFİKASI DESTEĞİ
ÜCRETSİZ
SİTE TAŞIMA
30 GÜN PARA İADE GARANTİSİ
24/7/365
TEKNİK DESTEK

MÜŞTERİLERİMİZ NE DİYOR

HER SORUNUZUN MUTLAKA BİR CEVAP VAR!

Web Hosting servisi almak istiyorum ancak işlemlerin nasıl yapılacağını bilmiyorum?

Bir web sitenizin olabilmesi için öncelikle firmaniz.com şeklinde bir domain / alan adı belirlemeniz gerekmektedir. Belirlediğiniz bu ismi (Alan adı) kullanabilmeniz için alan adını kendi adınıza tescil ettirmeniz gerekmektedir. Alan adı tescil servisi bu hizmeti kapsamaktadır.

Alan adları satın alınamazlar, asgari bir yıl olmak üzere belirli bir kullanım süresi için tescil edilebilirler. Alan adınızı tescil süresi bitiminde yenilemediğiniz taktirde alan adınızı bir başkası tescil edebilir.

Web sitenizi daha sonra oluşturmak istiyorsanız tescil ettirdiğiniz domain için daha sonra da hosting hizmeti satın alabilirsiniz.

WordPress, Joomla,Vbulletin, SMF kurulumuna yardımcı oluyor musunuz?

XSunucu Farkı İle WordPress,Smf,Vbulletin Joomla, Drupal ve benzeri onlarca hazır script son sürümleri ile kontrol paneliniz’de. Kendinizde Rahatlıkla tek tıklama ile kurabilir takıldığınız noktalarda destek ekibimizden destek alabilirsiniz.

Web siteme, kaç kişi girmiş çıkmış, ne zaman girilmiş gibi detaylı raporları nasıl alabilirim?

XSunucu, müşterilerine tamamıyla ücretsiz olarak sunduğu bir hizmet de “İSTATİSTİKLER” sayfasıdır. Cpanelde bulunan “Awstats” ile yıllık, aylık, haftalık, saatlik hitlere bakabilirsiniz. Ayrıcı hangi arama motorlarından girilmiş, hangi IP’lerden girilmiş, hangi kelimelerden girilmiş olduğunu görebilirsiniz.

Tescil hizmetini XSunucu’dan hosting ürününü başka bir firmadan alabilir miyim?

Evet. Domain tescil hizmetini XSunucu’dan hosting servisini ise başka bir firmadan satın alabilirsiniz.

Web Hosting müşteri kontrol paneli sağlıyor musunuz?

Evet, web hosting kontrol paneli ile kendi başınıza hesaplarınızı kontrol edebilirsiniz, ftp şifre talebi, veritabanı talebi, hosting ve domain kontrol ve destek bildirimi oluşturabilsiniz. Müşteri Panelinde bu bilgileriniz yer almaktadır.

Web Hosting sunucularında yedekleme sistemi var mı?

XSunucu web hosting sunucularında barınan veritabanları , web siteleri, eposta kutuları ve diğer veriler günlük olarak CDP (Continious Data Protection) teknolojisi ile geriye dönük olarak yedeklenmektedir.

Xsunucu’dan Satın aldığım web hosting ürününü daha sonra değiştirebilir miyim ?

Evet, Satın almış olduğunuz bir web hosting ürününden diğer bir web hosting ürününe geçiş yapabilirsiniz. Bu işlem paketinizi genişletme veya daraltma yönünde olabilir.Paket değişikliği işlemini Xsunucu yönetim paneli aracılığı ile otomatik olarak gerçekleştirebilirsiniz.Paket değişikliğini yapamıyorsanız Teknik Destek ekibinden yardım alabilirsiniz.

Tek Tıkla Kurulum Hizmetiniz Nedir?

Tek tık uygulaması Vbulletin, Joomla , WordPress , SMF , Magento , Php Nuke , Drupal ve benzeri yazılımları web sayfanıza Cpanel kontrol panelinden kolaylıkla kurabileceğiniz bir hizmetimizdir.

İş ortaklarımız

cpanelpleskrapidsslpaypalapachemysqlvmwarenginxcentoslitespeed1ubuntuopteron