EN İYİ PERFORMANS VE SORUNSUZ RESELLER HOSTİNG DENEYİMİ

İster müşterileriniz için ister kendi siteleriniz için toptan bir barındırma çözümü arıyorsanız Performans Reseller Hosting paketimiz tam size göre! Türkiye’nin ve Avrupa’nın en geniş disk alanı seçeneği, en uygun fiyatla yalnızca kısa bir süre için XSunucu’da! Tüm siteler için e-posta ve MySQL veritabanı ekleme imkanı! Kendinize ve müşterilerinize ihtiyacınız kadar alt özellik tanımlamaları yapabilirsiniz. Barındırdığınız hosting hesaplarınız için CPU hız limiti %100! Çekirdek hızının tamamını siteleriniz için kullanabilirsiniz.

reseller-hosting

PROFESYONEL RESELLER HOSTİNG PAKETLERİ

Kurumsal Hosting Özellikleri

SİZE UYGUN PAKETİ SEÇİN

Giriş

50₺/Ay
Satın Al

EN İYİ TERCİH

Orta

₺100/Ay
Satın Al

Pro

₺300/Yıl
Satın Al

Web Alanı

30.000MB

200.000MB

500.000MB

Aylık Trafik

300.000MB

2.000.000MB

Sınırsız

Web site Barındırma

30

100

1000

Eposta Adeti

150

150

1.000

MySQL Veritabanı

30

150

1.000

Alt Etki Alan (Sub domain)

150

500

1.000

Max. Ftp Hesabı Sayısı

30

150

1.000

1 gbit/s hat ve port

DDOS Koruma

CPanel WHM

Günlük Yedekleme (Son 15 gün)

ModSecurity / G.D.

LiteSpeed Server


₺50/Ay
Satın Al

₺100/Ay
Satın Al

₺300/Ay
Satın Al

Tüm Web Hosting Paketlerinde Ortak Özellik

HER ÇEŞİT ALAN
ADINI DESTEKLER
YÜKSEK KAPASİTE
MYSQL VERİTABANI
TEK TUŞLA
SCRİPT KURULUMU
99.9% UPTİME
GARANTİSİ
TÜRKÇE KONTROL
PANELİ
ESNEK ÖDEME
SEÇENEKLERİ
SSL
SERTİFİKASI DESTEĞİ
ÜCRETSİZ
SİTE TAŞIMA
30 GÜN PARA
İADE GARANTİSİ
24/7/365
TEKNİK DESTEK

Müşterilerimiz ne diyor?

HER SORUNUZA BİR CEVABIMIZ VAR!

WEB HOSTİNG SERVİSİ ALMAK İSTİYORUM ANCAK İŞLEMLERİN NASIL YAPILACAĞINI BİLMİYORUM?

Bir web sitenizin olabilmesi için öncelikle firmaniz.com şeklinde bir domain / alan adı belirlemeniz gerekmektedir. Belirlediğiniz bu ismi (Alan adı) kullanabilmeniz için alan adını kendi adınıza tescil ettirmeniz gerekmektedir. Alan adı tescil servisi bu hizmeti kapsamaktadır.
Alan adları satın alınamazlar, asgari bir yıl olmak üzere belirli bir kullanım süresi için tescil edilebilirler. Alan adınızı tescil süresi bitiminde yenilemediğiniz taktirde alan adınızı bir başkası tescil edebilir.
Web sitenizi daha sonra oluşturmak istiyorsanız tescil ettirdiğiniz domain için daha sonra da hosting hizmeti satın alabilirsiniz.

WORDPRESS, JOOMLA,VBULLETİN, SMF KURULUMUNA YARDIMCI OLUYOR MUSUNUZ?

XSunucu Farkı İle WordPress,Smf,Vbulletin Joomla, Drupal ve benzeri onlarca hazır script son sürümleri ile kontrol paneliniz’de. Kendinizde Rahatlıkla tek tıklama ile kurabilir takıldığınız noktalarda destek ekibimizden destek alabilirsiniz.

WEB SİTEME, KAÇ KİŞİ GİRMİŞ ÇIKMIŞ, NE ZAMAN GİRİLMİŞ GİBİ DETAYLI RAPORLARI NASIL ALABİLİRİM?

XSunucu, müşterilerine tamamıyla ücretsiz olarak sunduğu bir hizmet de “İSTATİSTİKLER” sayfasıdır. Cpanelde bulunan “Awstats” ile yıllık, aylık, haftalık, saatlik hitlere bakabilirsiniz. Ayrıcı hangi arama motorlarından girilmiş, hangi IP’lerden girilmiş, hangi kelimelerden girilmiş olduğunu görebilirsiniz.

TESCİL HİZMETİNİ XSUNUCU’DAN HOSTİNG ÜRÜNÜNÜ BAŞKA BİR FİRMADAN ALABİLİR MİYİM?

Evet. Domain tescil hizmetini XSunucu’dan hosting servisini ise başka bir firmadan satın alabilirsiniz.

WEB HOSTİNG MÜŞTERİ KONTROL PANELİ SAĞLIYOR MUSUNUZ?

Evet, web hosting kontrol paneli ile kendi başınıza hesaplarınızı kontrol edebilirsiniz, ftp şifre talebi, veritabanı talebi, hosting ve domain kontrol ve destek bildirimi oluşturabilsiniz. Müşteri Panelinde bu bilgileriniz yer almaktadır.

WEB HOSTİNG SUNUCULARINDA YEDEKLEME SİSTEMİ VAR MI?

XSunucu web hosting sunucularında barınan veritabanları , web siteleri, eposta kutuları ve diğer veriler günlük olarak CDP (Continious Data Protection) teknolojisi ile geriye dönük olarak yedeklenmektedir.

XSUNUCU’DAN SATIN ALDIĞIM WEB HOSTİNG ÜRÜNÜNÜ DAHA SONRA DEĞİŞTİREBİLİR MİYİM ?

Evet, Satın almış olduğunuz bir web hosting ürününden diğer bir web hosting ürününe geçiş yapabilirsiniz. Bu işlem paketinizi genişletme veya daraltma yönünde olabilir.Paket değişikliği işlemini Xsunucu yönetim paneli aracılığı ile otomatik olarak gerçekleştirebilirsiniz.Paket değişikliğini yapamıyorsanız Teknik Destek ekibinden yardım alabilirsiniz.

TEK TIKLA KURULUM HİZMETİNİZ NEDİR?

Tek tık uygulaması Vbulletin, Joomla , WordPress , SMF , Magento , Php Nuke , Drupal ve benzeri yazılımları web sayfanıza Cpanel kontrol panelinden kolaylıkla kurabileceğiniz bir hizmetimizdir.

İş ortaklarımız

cpanelpleskrapidsslpaypalapachemysqlvmwarenginxcentoslitespeed1ubuntuopteron