VDS Sunucu - Yüksek Performanslı SSD Web Sunucu

Vds sunucu, SSD Disk sürücüleri (Solid State Drive) geleneksel sabit disk sürücülerin tam tersine, NAND flash tabanlı bir depolama birimidir.Manyetik disklere göre daha düşük güç tüketimi, yüksek performans ve yüksek dayanılıklılık sağlamaktadır.

 

SSD Disk türleri VDS sunucular için olağanüstü bir okuma ve yazma gücüne sahiptir. Normal disklere göre bu rakam %150 civarındadır. Normal disklere göre veri kayıplarınında hemen hemen önüne geçmiştir. Elektronik olarak çalışan bu disk, gürültüyü tamamen kesmesinin yanı sıra bozulma durumlarına karşı ekstra dayanıklılık sağlamaktadır.

Üstün Performanslı VDS Sunucular

VDS Sunucu Özellikleri

SİZE UYGUN PAKETİ seçin

WEBSERVER-1

35₺/Ay
Satın Al

En iyi Tercih

Webserver-2

  50₺/Ay
Satın Al

WebServer-3

 75₺/Ay

Satın Al

Sunucu

Xeon E5-1650v2/E3-1270v3

Xeon E5-1650v2/E3-1270v3

Xeon E5-1650v2/E3-1270v3

İşlemci (CPU)

1*3.5GHZ CPU

1*3.5GHZ CPU

1*3.5GHZ CPU

Ram

1 GB DDR3/ECC RAM

2 GB DDR3/ECC RAM

4 GB DDR3/ECC RAM

Web Alanı

20 GB SSD HDD

30 GB SSD HDD

60 GB SSD HDD

Sınırsız Trafik

1 Dedicated IP Adresi

Linux/Windows

1 Gbits Hat ve Port

₺35/Ay Aylık Fiyatı ₺45
Satın Al

₺50/Ay Aylık Fiyatı ₺65
Satın Al

₺75/Ay Ay Fiyatı ₺85
Satın Al

Tüm Web Hosting Paketlerinde Ortak Özellik

HER ÇEŞİT ALAN
ADINI DESTEKLER
YÜKSEK KAPASİTE MYSQL VERİTABANI
TEK TUŞLA SCRİPT
KURULUMU
99.9% UPTİME
GARANTİSİ
TÜRKÇE KONTROL
PANELİ
ESNEK ÖDEME SEÇENEKLERİ
SSL
SERTİFİKASI DESTEĞİ
ÜCRETSİZ
SİTE TAŞIMA
30 GÜN PARA İADE GARANTİSİ
24/7/365
TEKNİK DESTEK

MÜŞTERİLERİMİZ NE DİYOR

HER SORUNUZUN MUTLAKA BİR CEVAP VAR!

Web Hosting servisi almak istiyorum ancak işlemlerin nasıl yapılacağını bilmiyorum?

Bir web sitenizin olabilmesi için öncelikle firmaniz.com şeklinde bir domain / alan adı belirlemeniz gerekmektedir. Belirlediğiniz bu ismi (Alan adı) kullanabilmeniz için alan adını kendi adınıza tescil ettirmeniz gerekmektedir. Alan adı tescil servisi bu hizmeti kapsamaktadır.

Alan adları satın alınamazlar, asgari bir yıl olmak üzere belirli bir kullanım süresi için tescil edilebilirler. Alan adınızı tescil süresi bitiminde yenilemediğiniz taktirde alan adınızı bir başkası tescil edebilir.

Web sitenizi daha sonra oluşturmak istiyorsanız tescil ettirdiğiniz domain için daha sonra da hosting hizmeti satın alabilirsiniz.

WordPress, Joomla,Vbulletin, SMF kurulumuna yardımcı oluyor musunuz?

XSunucu Farkı İle WordPress,Smf,Vbulletin Joomla, Drupal ve benzeri onlarca hazır script son sürümleri ile kontrol paneliniz’de. Kendinizde Rahatlıkla tek tıklama ile kurabilir takıldığınız noktalarda destek ekibimizden destek alabilirsiniz.

Web siteme, kaç kişi girmiş çıkmış, ne zaman girilmiş gibi detaylı raporları nasıl alabilirim?

XSunucu, müşterilerine tamamıyla ücretsiz olarak sunduğu bir hizmet de “İSTATİSTİKLER” sayfasıdır. Cpanelde bulunan “Awstats” ile yıllık, aylık, haftalık, saatlik hitlere bakabilirsiniz. Ayrıcı hangi arama motorlarından girilmiş, hangi IP’lerden girilmiş, hangi kelimelerden girilmiş olduğunu görebilirsiniz.

Tescil hizmetini XSunucu’dan hosting ürününü başka bir firmadan alabilir miyim?

Evet. Domain tescil hizmetini XSunucu’dan hosting servisini ise başka bir firmadan satın alabilirsiniz.

Web Hosting müşteri kontrol paneli sağlıyor musunuz?

Evet, web hosting kontrol paneli ile kendi başınıza hesaplarınızı kontrol edebilirsiniz, ftp şifre talebi, veritabanı talebi, hosting ve domain kontrol ve destek bildirimi oluşturabilsiniz. Müşteri Panelinde bu bilgileriniz yer almaktadır.

Web Hosting sunucularında yedekleme sistemi var mı?

XSunucu web hosting sunucularında barınan veritabanları , web siteleri, eposta kutuları ve diğer veriler günlük olarak CDP (Continious Data Protection) teknolojisi ile geriye dönük olarak yedeklenmektedir.

Xsunucu’dan Satın aldığım web hosting ürününü daha sonra değiştirebilir miyim ?

Evet, Satın almış olduğunuz bir web hosting ürününden diğer bir web hosting ürününe geçiş yapabilirsiniz. Bu işlem paketinizi genişletme veya daraltma yönünde olabilir.Paket değişikliği işlemini Xsunucu yönetim paneli aracılığı ile otomatik olarak gerçekleştirebilirsiniz.Paket değişikliğini yapamıyorsanız Teknik Destek ekibinden yardım alabilirsiniz.

Tek Tıkla Kurulum Hizmetiniz Nedir?

Tek tık uygulaması Vbulletin, Joomla , WordPress , SMF , Magento , Php Nuke , Drupal ve benzeri yazılımları web sayfanıza Cpanel kontrol panelinden kolaylıkla kurabileceğiniz bir hizmetimizdir.

İş ortaklarımız

cpanelpleskrapidsslpaypalapachemysqlvmwarenginxcentoslitespeed1ubuntuopteron